GNRPX (Pleckstrin Homology Domain-containing Family J Member 1, PH Domain-containing Family J Member 1, Guanine Nucleotide-releasing Protein X, PLEKHJ1, FLJ10297)

Größe

£685.00

SKU:: 127450
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human GNRPX, aa1-149 (NM_018049; NP_060519.1).
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Expressed in testis and liver. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEPVGALLLERCRVVREEPGTFSISFIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFGISEEARFQLSGLQA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.