Glypican 3 (Glypican-3, GPC3, DGSX, GTR2-2, Intestinal Protein OCI-5, MXR7, OCI5, OCI-5, SDYS, SGB, SGBS, SGBS1)

Größe

£698.00

SKU:: 127389
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa121-220 from human GPC3 (NP_004475.1) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C12
Format:: Supplied as a liquid in ascites fluid.
Weitere Details:: GPC3 is a cell surface proteoglycan that bears heparan sulfate. This protein may be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs, and may play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. Members of the glypican-related integral membrane proteoglycan family contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol (GPI) linkage. These proteins may play a role in the control of cell division, growth regulation, and tumor predisposition. Deletion mutations in GPC3 are the cause of Simpson-Golabi-Behmel syndrome (SGBS), also known as Simpson dysmorphia syndrome (SDYS). SGBS is a condition characterized by pre- and postnatal overgrowth (gigantism) with visceral and skeletal anomalies. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice