Glyoxalase I (GLO1, GLOD1, Glx I, GLYI, Aldoketomutase, Ketone-aldehyde Mutase, Lactoylglutathione Lyase, Methylglyoxalase, S-D-lactoylglutathione Methylglyoxal Lyase)

Größe

£685.00

SKU:: 127388
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-98 from human GLO1 (AAH11365.1) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4C12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The enzyme GLO1 is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAEPQPPSGGLTDEAALSYCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKAT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.