GLTSCR2 (Glioma Tumor Suppressor Candidate Region Gene 2 Protein, p60, PICT-1, PICT1)

Größe

£685.00

SKU:: 127360
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa402-479 from human GLTSCR2 (NP_056525) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5A8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Interacts with HSV-1 early proteins ICP22 and ICP0. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: KPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.