GIF (Gastric Intrinsic Factor, Intrinsic Factor, IF, INF, IFMH)

Größe

£685.00

SKU:: 127301
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa318-417 from human GIF (NP_005133) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D9
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Promotes absorption of the essential vitamin cobalamin (Cbl) in the ileum. After interaction with CUBN, the GIF-cobalamin complex is internalized via receptor-mediated endocytosis. Applications: Suitable for use in ELISA, Immunofluorescence and Immunoprecipitation. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: INNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.