GGTLA1 (Gamma-glutamyltransferase 5, Gamma-glutamyltranspeptidase 5, GGT 5, GGT5, Gamma-glutamyltransferase-like Activity 1, Gamma-glutamyl Transpeptidase-related Enzyme, GGT-rel)

Größe

£698.00

SKU:: 127291
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa510-586 from human GGTLA1 (NP_004112.1) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3E10
Format:: Supplied as a liquid in ascites fluid.
Weitere Details:: This gene is a member of gamma-glutamyl transpeptidase enzymes. This enzyme consists of a heavy and a light chain, and is able to hydrolyze the gamma-glutamyl moiety of glutathione. It converts leukotriene C4 to leukotriene D4, however, it doesn't convert synthetic substrates that are commonly used to assay gamma-glutamyl transpeptidase. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.