127271-BIOTIN
Geminin (GMNN, GEM, Geminin DNA Replication Inhibitor, DNA Replication Inhibitor, RP3-369A17.3) (Biotin)
Größe
£914.00
- SKU:
- 127271-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa110-209 from human GMNN (AAH05185) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1A8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Geminin inhibits DNA replication by preventing the incorporation of MCM complex into the prereplication complex (pre-RC). It is absent during the G1 phase, accumulates during the S, G2, and M phases, and disappears during the metaphase-anaphase transition. Geminin contains 212 amino acids and has a destruction box sequence (RRTLKVIQP). Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice