GDF3 (Growth/Differentiation Factor 3, GDF-3, UNQ222/PRO248, KFS3, MCOP7, MCOPCB6)

Größe

£685.00

SKU:: 127253
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa265-364 from GDF3 (NP_065685) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Homodimer or heterodimer. But, in contrast to other members of this family, cannot be disulfide-linked. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVDECGCG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.