127245-APC
GCSF (Granulocyte Colony-stimulating Factor, G-CSF, Pluripoietin, Filgrastim, Lenograstim, CSF3, C17orf33) (APC)
Größe
£927.00
- SKU:
- 127245-APC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa31-207 from human CSF3 (NP_757373).
- Klon:
- 2C5
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- Granulocyte-colony Stimulating Factor (G-CSF) is a pleiotropic cytokine that influences differentiation, proliferation and activation of the neutrophilic granulocyte lineage. G-CSF signals via the G-CSF receptor, a heavily glycosylated 812aa polypeptide with a single transmembrane domain. Stimulation of the G-CSFR results in the activation of the Ras/MAPK pathway and phosphorylation of the adaptor protein Shc. Applications: Suitable for use in FLISA and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice