GCSF (Granulocyte Colony-stimulating Factor, G-CSF, Pluripoietin, Filgrastim, Lenograstim, CSF3, C17orf33) (Not for Export EU)

Größe

£760.00

SKU:: 127243
Reinheit:: Serum
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length protein corresponding to aa1-207 from human CSF3, (NP_000750.1).
Format:: Supplied as a liquid.
Weitere Details:: Granulocyte-colony Stimulating Factor (G-CSF) is a pleiotropic cytokine that influences differentiation, proliferation and activation of the neutrophilic granulocyte lineage. G-CSF signals via the G-CSF receptor, a heavily glycosylated 812aa polypeptide with a single transmembrane domain. Stimulation of the G-CSFR results in the activation of the Ras/MAPK pathway and phosphorylation of the adaptor protein Shc. Applications: Suitable for use in ELISA, Immunofluorescence, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.