127235-PE
GCM1 (Glial Cells Missing Homolog 1, GCM Motif Protein 1, Chorion-specific Transcription Factor GCMa, GCMa) (PE)
Größe
£914.00
- SKU:
- 127235-PE
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa108-166 from GCM1 (NP_003634) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2E11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). This protein is a homolog of the Drosophila glial cells missing gene (gcm). It binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. Applications: Suitable for use in FLISA, Immunofluorescence, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1.7ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice