127230-APC
GCLC (Glutamate-cysteine Ligase Catalytic Subunit, GCL, GLCL, GLCLC, Gamma-glutamylcysteine Synthetase, Gamma-ECS, GCS Heavy Chain) (APC)
Größe
£927.00
- SKU:
- 127230-APC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa528-637 from human GCLC (NP_001489) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3H1
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. The gene for catalytic subunit (GLCLC) encodes a protein of 367aa with a calculated molecular weight of 72.773kD and maps to chromosome 6. The regulatory subunit is derived from a different gene located on chromosome 1p21-p22. GLCLC deficiency in human is associated with enzymopathic hemolytic anemia. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice