GC1qR (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial, Glycoprotein gC1qBP, C1qBP, GC1q-R Protein, GC1QBP, Hyaluronan-binding Protein 1, HABP1, Mitochondrial Matrix Protein p32, p33, SF2P32)

Größe

£685.00

SKU:: 127217
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa173-282 from human C1QBP (NP_001203) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. C1QBP is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.