127196
GBA (Glucosylceramidase, Acid beta-glucosidase, Alglucerase, Beta-glucocerebrosidase, D-glucosyl-N-acylsphingosine Glucohydrolase, Imiglucerase, GC, GLUC)
Größe
£685.00
- SKU:
- 127196
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa146-235 from human GBA with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2e2
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12 kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants encoding the same protein. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice