127182-ML650
GATA1 (Erythroid Transcription Factor, Eryf1, GATA-binding Factor 1, GATA-1, GF-1, NF-E1 DNA-binding Protein, ERYF1, GF1) (MaxLight 650)
Größe
£914.00
- SKU:
- 127182-ML650
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa123-199 from human GATA1 (NM_002049) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3G6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Weitere Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. GATA1 is the founding member of a family of transcription factors distinguished by a zinc finger domain that recognizes the DNA consensus motif (A/T)GATA(A/G). Functionally important GATA motifs have been identified in the regulatory regions of virtually all erythroid-expressed genes, including globins, heme biosynthetic enzymes, erythroid transcription factors and erythroid membrane proteins. GATA1 is thus a DNA-binding protein, essential for the survival and maturation of lineage-committed erythroid precursors. GATA1 is required for normal erythropoiesis. Human GATA1 gene is mapped to chromosomal region Xp11.23. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPC Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice