127182-BIOTIN
GATA1 (Erythroid Transcription Factor, Eryf1, GATA-binding Factor 1, GATA-1, GF-1, NF-E1 DNA-binding Protein, ERYF1, GF1) (Biotin)
Größe
£914.00
- SKU:
- 127182-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa123-199 from human GATA1 (NM_002049) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3G6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- GATA1 is the founding member of a family of transcription factors distinguished by a zinc finger domain that recognizes the DNA consensus motif (A/T)GATA(A/G). Functionally important GATA motifs have been identified in the regulatory regions of virtually all erythroid-expressed genes, including globins, heme biosynthetic enzymes, erythroid transcription factors and erythroid membrane proteins. GATA1 is thus a DNA-binding protein, essential for the survival and maturation of lineage-committed erythroid precursors. GATA1 is required for normal erythropoiesis. Human GATA1 gene is mapped to chromosomal region Xp11.23. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPC Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice