GAP43 (Neuromodulin, Axonal Membrane Protein GAP-43, Growth-associated Protein 43, Neural Phosphoprotein B-50, pp46)

Größe

£685.00

SKU:: 127159
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-238 from human GAP43 (AAH07936) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3C11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: GAP43 is expressed by developing and regenerating neurons, and to a lesser extent, reactive glial cells.It is used widely to specifically label injured neurons and to score neuronal regeneration. GAP43 is also a neuronal growth cone protein thought to be involved in pathfinding. GAP43 is considered to be a crucial component of an effective regenerative response in the nervous system. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.