127128
GALNT1 (Polypeptide N-acetylgalactosaminyltransferase 1, Polypeptide GalNAc Transferase 1, GalNAc-T1, pp-GaNTase 1, Protein-UDP Acetylgalactosaminyltransferase 1, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1)
Größe
£685.00
- SKU:
- 127128
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human GALNT1, aa1-105 (AAH47746.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b and Muc7. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice