Galectin-3 (GAL3, Carbohydrate Binding Protein 35, CBP35, Galactose Specific Lectin 3, Galactoside Binding Protein, GALBP, IgE Binding Protein, Laminin Binding Protein, Lectin Galactose Binding Soluble 3, LGALS3, MAC2)

Größe

£685.00

SKU:: 127120
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human LGALS3, aa1-250 (AAH53667.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Lectins are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with betagalactoside moieties. Galactin-3 regulates a number of biological processes, including embryogenesis, inflammatory responses, cell progression and metastasis. Galectin-3 can function intracellularly in controlling cell cycle and preventing T-cell apoptosis, and also extracellularly, in activating various cells, including monocytes/macrophages, mast cells, neutrophils, and lymphocytes. Human Galectin-3 is a globular 26kD protein containing 250aa residues. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice