GAK (Cyclin-G-associated Kinase, FLJ16629, FLJ40395, MGC99654)

Größe

£685.00

SKU:: 127103
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa151-250 from human GAK (AAH08668) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4C10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: GAK, a member of the Ser/Thr protein kinase family, associates with cyclin G and CDK5. It appears to act as an auxilin homolog that is involved in the uncoating of clathrin-coated vesicles by Hsc70 in non-neuronal cells. Expression oscillates slightly during the cell cycle, peaking at G1. GAK localizes to the perinuclear area and to the trans-Golgi network. It is also observed on the plasma membrane, probably at focals adhesions. Expression is ubiquitous, wiht highest levels in testis. The protein contains 1 J domain and 1 tensin domain. Applications: Suitable for use in ELISA, Immunoprecipitation and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPKACTQP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice