127103-PE
GAK (Cyclin-G-associated Kinase, FLJ16629, FLJ40395, MGC99654) (PE)
Größe
£914.00
- SKU:
- 127103-PE
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa151-250 from human GAK (AAH08668) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4C10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- GAK, a member of the Ser/Thr protein kinase family, associates with cyclin G and CDK5. It appears to act as an auxilin homolog that is involved in the uncoating of clathrin-coated vesicles by Hsc70 in non-neuronal cells. Expression oscillates slightly during the cell cycle, peaking at G1. GAK localizes to the perinuclear area and to the trans-Golgi network. It is also observed on the plasma membrane, probably at focals adhesions. Expression is ubiquitous, wiht highest levels in testis. The protein contains 1 J domain and 1 tensin domain. Applications: Suitable for use in FLISA, Immunoprecipitation and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPKACTQP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice