127097
GAGE1 (G Antigen 1, GAGE-1, Antigen MZ2-F, Cancer/Testis Antigen 4.1, CT4.1)
Größe
£685.00
- SKU:
- 127097
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human GAGE1, aa1-139 (NP_001459.2).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- The GAGE1 gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The GAGE1 cDNA contains a 143-bp insertion, located in the coding sequence near the termination codon, that is absent from the other cDNAs. Autologous cytolytic T lymphocytes recognise the antigenic peptide YRPRPRRY, which is also encoded by several other family members. Nothing is presently known about the function of this protein. An alternatively spliced transcript variant has been found for this gene. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQTGILWLLMNNCFLNLSPRKP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice