GADD45GIP1 (Growth Arrest and DNA Damage-inducible Proteins-interacting Protein 1, CKII beta-associating Protein, CR6-interacting Factor 1, CRIF1, Papillomavirus L2-interacting Nuclear Protein 1, PLINP-1, p53-responsive Gene 6 Protein, PLINP1, PRG6, MGC4667, MGC4758)

Größe

£685.00

SKU:: 127096
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human GADD45GIP1, aa1-222 (NP_443082).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: GADD45GIP1, is a nuclear protein that plays a role in apoptosis control. This protein is expressed in a variety of tissues, including heart, thyroid, trachea, kidney, ovary, pancreas, testis and stomach. It functions as a negative regulator of G1 to S phase cell cycle production, specifically by working with GADD45 proteins to inhibit the activity of cyclin-dependent kinases. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.