GADD45A (Growth Arrest And DNA-damage-inducible Protein GADD45 alpha, DNA-damage-inducible Transcript 1, DDIT-1, DDIT1, GADD45)

Größe

£685.00

SKU:: 127093
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa76-165 from human GADD45A (AAH11757) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3D12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: GADD45A responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45A gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.