127091-HRP
GADD153 (DNA Damage-inducible Transcript 3 Protein, DDIT-3, C/EBP-homologous Protein, CHOP, C/EBP-homologous Protein 10, CHOP-10, Growth Arrest and DNA Damage-inducible Protein GADD153, DDIT3, CHOP, CHOP10) (HRP)
Größe
£914.00
- SKU:
- 127091-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-90 from human DDIT3 (AAH03637) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2G3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- GADD 153 was described as a growth arrest and DNA damage inducible gene that encodes a C/EBP- related nuclear protein. GADD153 expression is induced by a variety of cellular stresses, including nutrient deprivation and metabolic perturbations. GADD153 functions to block cells in G1 to S phase in cell cycle progression and acts by dimerizing with other C/EBP proteins to direct GADD153 dimers away from "classical" C/EBP binding sites, recognizing unique "non-classical" sites instead. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice