127091-BIOTIN
GADD153 (DNA Damage-inducible Transcript 3 Protein, DDIT-3, C/EBP-homologous Protein, CHOP, C/EBP-homologous Protein 10, CHOP-10, Growth Arrest and DNA Damage-inducible Protein GADD153, DDIT3, CHOP, CHOP10) (Biotin)
Größe
£914.00
- SKU:
- 127091-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-90 from human DDIT3 (AAH03637) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2G3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- GADD 153 was described as a growth arrest and DNA damage inducible gene that encodes a C/EBP- related nuclear protein. GADD153 expression is induced by a variety of cellular stresses, including nutrient deprivation and metabolic perturbations. GADD153 functions to block cells in G1 to S phase in cell cycle progression and acts by dimerizing with other C/EBP proteins to direct GADD153 dimers away from "classical" C/EBP binding sites, recognizing unique "non-classical" sites instead. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice