127068
G0S2 (G0/G1 Switch Protein 2, G0/G1 Switch Regulatory Protein 2, Putative Lymphocyte G0/G1 Switch Gene)
Größe
£760.00
- SKU:
- 127068
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human G0S2, aa1-103 (AAH09694.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Promotes apoptosis by binding to BCL2, hence preventing the formation of protective BCL2-BAX heterodimers. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice