G-Protein Coupled Receptor 127 (Putative EGF-like module-containing mucin-like hormone receptor-like 4, G-protein coupled receptor PGF16, EMR4, GPR127, PGR16)

Größe

£685.00

SKU:: 127065
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa21-94 from human EMR4 (XP_377506) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2H8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: This protein is a member of the G-protein coupled receptor 2 family and the LN-TM7 subfamily. This protein could mediate the cellular interaction between myeloid cells and B cells. It forms a heterodimer, consisting of a large extracellular region (alpha-subunit) non-covalently linked to a seven-transmembrane moiety (beta subunit). This protein however, could be a product of a pseudogene as it seems to have become non-functional after human-chimpanzee speciation. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice