127065-BIOTIN
G-Protein Coupled Receptor 127 (Putative EGF-like module-containing mucin-like hormone receptor-like 4, G-protein coupled receptor PGF16, EMR4, GPR127, PGR16) (Biotin)
Größe
£914.00
- SKU:
- 127065-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa21-94 from human EMR4 (XP_377506) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2H8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- This protein is a member of the G-protein coupled receptor 2 family and the LN-TM7 subfamily. This protein could mediate the cellular interaction between myeloid cells and B cells. It forms a heterodimer, consisting of a large extracellular region (alpha-subunit) non-covalently linked to a seven-transmembrane moiety (beta subunit). This protein however, could be a product of a pseudogene as it seems to have become non-functional after human-chimpanzee speciation. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice