127054-HRP
G-Protein Coupled Receptor 161 (G-Protein-coupled Receptor 161, G-protein Coupled Receptor 161, GPR161, G-protein Coupled Receptor RE2, FLJ33952, RE2) (HRP)
Größe
£914.00
- SKU:
- 127054-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa362-461 from GPR161 (NP_722561) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1B2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- GPR161/RE2 is an Orphan-U GPCR with an unknown ligand. RE2 is a member of the rhodopsin family of G protein-coupled receptors and may aid in the regulation of aggression and appetite. ESTs have been identified in brain, colon, heart/melanocyte/uterus, lung, prostate, and uterus libraries. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLD* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice