FXYD3 (FXYD Domain-containing Ion Transport Regulator 3, Chloride Conductance Inducer Protein Mat-8, Mammary Tumor 8kD Protein, Phospholemman-like, MAT8, PLML, MGC111076)

Größe

£685.00

SKU:: 127041
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human FXYD3, aa21-88 (AAH05238).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Induces a hyperpolarization-activated chloride current when expressed in Xenopus oocytes. May be a modulator capable of activating endogenous oocyte channels. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.