FUT7 (Alpha-(1,3)-fucosyltransferase, Fucosyltransferase 7, Fuc-TVII, Fucosyltransferase VII, FucT-VII, Galactoside 3-L-fucosyltransferase, Selectin Ligand Synthase)

Größe

£685.00

SKU:: 127027
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa262-342 from human FUT7 (NP_004470) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May catalyze alpha-1,3 glycosidic linkages involved in the expression of sialyl Lewis X antigens. Applications: Suitable for use in Western Blot and ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.