127020-PE

FUNDC2 (HCBP6, FUN14 Domain-containing Protein 2, Cervical Cancer Proto-oncogene 3 Protein, HCC-3, Hepatitis C Virus Core-binding Protein 6, DC44, FLJ33773, HCC3, MGC131676, MGC2495, PD03104) (PE)

Größe

£914.00

SKU:: 127020-PE
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-100 from human FUNDC2 (NP_076423) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2G12
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLFGQESGPSAEKYSVATQLFIGGVTGWCTGFI Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.