FUCA2 (Fucosidase alpha-L- 2 Plasma, Alpha-L-fucoside Fucohydrolase 2, Alpha-L-fucosidase 2, dJ20N2.5, MGC1314, Plasma alpha-L-fucosidase, PSEC0151, RP1-20N2.5, UNQ227/PRO260)

Größe

£685.00

SKU:: 127010
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa368-466 from human FUCA2 (NP_114409) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Alpha-L-fucosidase catalyzes the hydrolysis of terminal alpha-L-fucosidase linkages in glycosphingolipids and glycoproteins. At least 2 separate polymorphic alpha-L-fucosidases are recognized in man. The FUCA2 locus regulates the level of alpha-fucosidase in plasma and fibroblasts but not in leukocytes. In fucosidosis, deficiency of alpha-L-fucosidase is found in both plasma and leukocytes. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YETHTWRSQNDTVTPDVWYTSKPKEKLVYAIFLKWPTSGQLFLGHPKAILGATEVKLLGHGQPLNWISLEQNGIMVELPQLTIHQMPCKWGWALALTNV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.