Frizzled 4 (Frizzled Family Receptor 4, Frizzled-4, Fz-4, FZD4, FZD4S, FzE4, hFz4, CD344, EVR1, FEVR, MGC34390)

Größe

£685.00

SKU:: 126980
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa107-207 from FZD4 (NP_036325) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3G7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: There is evidence that CD344 may play a role in retinal angiogenesis, since defects in CD344 are responsible for the familial retinal disease known as exudative vitreoretinopathy 1 (FEVR), and also the cause of the retinal neovascularization disease, Criswick-Schepens syndrome. CD344 has been shown to be a marker for neuronal stem cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGY* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.