126958-BIOTIN
FOXP1 (Forkhead Box Protein P1, HSPC215, 12CC4, FLJ23741, hFKH1B, HSPC215, MGC12942, MGC88572, MGC99551, QRF1) (Biotin)
Größe
£914.00
- SKU:
- 126958-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-115 from human FOXP1 (AAH05055) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4E3-G11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- FOXP1, an 85kD member of the winged helix/forkhead transcription factor family. The FOXP1 transcription factor is widely expressed in human tissues and is predominantly localised to the nucleus. However, the level of expression does vary between cells and between different tissues. The expression of FOXP1 is reported to be abnormal in a range of solid tumors. Studies suggest that FOXP1 functions as a transcriptional repressor. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice