126957-BIOTIN
FOXO3A (Forkhead Box O3A, Forkhead in Rhabdomyosarcoma-like 1, AF6q21 Protein, DKFZp781A0677, FKHR2, FKHRL1, FKHRL1P2, MGC12739, MGC31925) (Biotin)
Größe
£914.00
- SKU:
- 126957-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa361-460 from human FOXO3A (AAH21224) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1B11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Forkhead box O3A (FOXO3A) is a member of the forkhead family of transcription factors (FOXO), which play an important role in cellular proliferation, metabolism, stress tolerance, and aging. FOXO transcription factors have a characteristic forkhead domain and are located in the cytoplasm. Upon oxidative stress, FOXO3A translocates to the nucleus where binding to the DNA sequence 5'-[AG]TAAA[TC]A-3' occurs and IGF-1 is dephosphlorated, resulting in apoptosis. In order for the cell to survive, IGF-1 must be phosphlorated by AKT1/PKB at Thr32 and Ser-253, which will result in retention and inactivation of FOXO3A in the cytoplasm. Translocation of FOXO3A with the MLL gene has been associated with secondary acute leukemia. Applications: Suitable for use in Immunofluorescence, ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice