FOXF2 (Forkhead Box Protein F2, Forkhead-related Activator 2, FREAC-2, Forkhead-related Protein FKHL6, Forkhead-related tRanscription Factor 2, FKHL6, FREAC2)

Größe

£685.00

SKU:: 126945
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa346-443 from human FOXF2 (NP_001443) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3F5
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Probable transcription activator for a number of lung-specific genes. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 30ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.