FOSL2 (Fos-related Antigen 2, FRA-2, FRA2)

Größe

£685.00

SKU:: 126933
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa1-122 from human FOSL2 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B4-1C2
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Fra-2 has homologous sequence with c-Fos, Fra-1, and Fos B. It forms heterodimers with c-Jun that recognize specific DNA sequences, such as the binding site for transcription factor AP-1. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Immunofluorescence: 20ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MSVGLDLPQMLPGSPSPSLKEAFAEDGEAGEGGGRPSLEWRLQQLLPQHPLSLSWLLTSPQGTGPFLPSVVICHLLDQVLSLLHSPVPTPVHSSGPGSKQAVNSWPELSLWLVAHAPFLVVC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.