FMR1 (Fragile X Mental Retardation 1 Protein, Protein FMR-1, FMRP)

Größe

£685.00

SKU:: 126914
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa121-220 from human FMR1 (NP_002015) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2D4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: FMR1 binds RNA and is associated with polysomes. This protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ATKDTFHKIKLDVPEDLRQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIMRNEEASKQLESSRQLASRFH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.