TRIML1 (Probable E3 Ubiquitin-protein Ligase TRIML1, RING Finger Protein 209, Tripartite Motif Family-like Protein 1, RNF209, FLJ36180, MGC138638, MGC138639)

Größe

£685.00

SKU:: 126876
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa369-469 from human FLJ36180 (NP_848651) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Probable E3 ubiquitin-protein ligase which plays an important role in blastocyst development. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: PKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGVFLDYESGHIAFYNGTDESLIYSFPQASFQEALRPIFSPCLPNEGTNTDPLTICSLNSHV* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.