SPEF2 (Sperm Flagellar Protein 2, Protein KPL2, KIAA1770, KPL2, CT122, FLJ23164, FLJ23577, FLJ25395, MGC102842)

Größe

£685.00

SKU:: 126866
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa324-423 from human FLJ23577 (NP_079143) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4B10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Required for correct axoneme development. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.