126841-APC
FKHR (Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead In Rhabdomyosarcoma, FOXO1A, FOXO1) (APC)
Größe
£927.00
- SKU:
- 126841-APC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa556-655 from human FOXO1A (NP_002006) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4E9
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- FKHR gene was first identified by virtue of its fusion to the PAX3 gene in the t(2;13) translocation found in the pediatric soft tissue tumor alveolar rhabdomyosarcoma . FKHR gene encodes for a protein containing a DNA-binding motif shared with members of the HNF-3:forkhead family of transcription factors. The protein acts as a potential Akt nuclear target in metabolic and survival pathways. The protein may also play a role in myogenic growth and differentiation. Human FKHR gene is usually localized in the chromosomal region 13q14.1. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice