126838-BIOTIN
FKBP5 (FK506-binding Protein 5, Peptidyl-prolyl cis-trans Isomerase FKBP5, PPIase FKBP5, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 51kD FK506-binding Protein, 51kD FKBP, FKBP-51, 54kD Progesterone Receptor-associated Immunophilin, FKBP54, p54 Protein, FF1 Antigen, HSP90-binding Immunophilin, Androgen-regulated Protein 6, FKBP-5, FKBP52, AIG6, FKBP51) (Biotin)
Größe
£914.00
- SKU:
- 126838-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-457 from human FKBP5 (AAH42605) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3D1-1B10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- The protein is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90kD heat shock protein and P23 protein. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice