FIS1 (Mitochondrial Fission 1 Protein, FIS1 Homolog, hFis1, Tetratricopeptide Repeat Protein 11, TPR Repeat Protein 11, TTC11, CGI-135)

Größe

£685.00

SKU:: 126823
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-153 from human FIS1 (AAH03540) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1G9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: hFis1 is a novel molecule that was discovered as part of the mammalian fission machinery. Fis 1 has been suggested to play a role in regulation of the fission processes that might be involved in apoptotic mechanisms. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.