Filensin (Beaded Filament Structural Protein 1, BFSP1, Lens Fiber Cell Beaded-filament Structural Protein CP 115, CP115, Lens Intermediate Filament-like Heavy, LIFL-H)

Größe

£685.00

SKU:: 126821
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa567-664 from human BFSP1 (NP_001186) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6B4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Filensin, also known as beaded filament structure protein 1, have two major component BFSP1 and BESP2. Filensin gene is mapped at 20p12.1-p11.23. The sequence of the predicted 665aa human protein is 62% and 50% identical to those of bovine and chicken filensin, respectively. However,it has less than 26% identity to other members of the intermediate filament (IF) family. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EESRRPCAMVTPGAEEPSIPEPPKPAADQDGAEVLGTRSRSLPEKGPPKALAYKTVEVVESIEKISTESIQTYEETAVIVETMIGKTKSDKKKSGEKS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.