FHL2 (Four and a Half LIM Domains Protein 2, FHL-2 Protein, Aging Associated Gene 11, AAG11, DRAL, LIM Domain Protein DRAL, Skeletal Muscle LIM Protein 3, SLIM3)

Größe

£685.00

SKU:: 126810
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-279 from human FHL2 (AAH14397) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2G3-1A5
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: LIM proteins contain a highly conserved double zinc finger motif called the LIM domain. FHL2 may function as a molecular transmitter linking various signaling pathways to transcriptional regulation. It negatively regulates the transcriptional repressor E4F1 and may function in cell growth. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.