FHIT (Fragile Histidine Triad Protein, AP3A Hydrolase, AP3Aase, Bis(5'-adenosyl)-triphosphatase, Diadenosine 5',5'''-P1,P3-triphosphate Hydrolase, Dinucleosidetriphosphatase, FRA3B)

Größe

£685.00

SKU:: 126806
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa31-130 from human FHIT (AAH32336) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1E3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: FHIT is a putative human tumor suppressor gene at chromosome 3p14.2 that was identified recently by positional cloning. Homozygous deletions within the FHIT locus have been observed in cell lines derived from cancers of the esophagus, stomach, colon, breast, kidney, and lung, and aberrant transcripts were observed in several types of primary tumors. This gene also encompasses the site of the t (3; 8) translocation breakpoint of familial renal clear cell carcinoma and the fragile site locus FRA3B. The1.1-kb FHIT cDNA is encoded by 10 small exons distributed over a genomic locus of about 1 Mb; the t (3;8) break falls between untranslated 5' exons 3 and 4. The protein is a dinucleoside 5', 5'''-P1, P3-triphosphate hydrolase and the histidine residues of the HIT sequence are critical for the Ap3A hydrolase activity of Fhit. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice