126806-APC
FHIT (Fragile Histidine Triad Protein, AP3A Hydrolase, AP3Aase, Bis(5'-adenosyl)-triphosphatase, Diadenosine 5',5'''-P1,P3-triphosphate Hydrolase, Dinucleosidetriphosphatase, FRA3B) (APC)
Größe
£927.00
- SKU:
- 126806-APC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa31-130 from human FHIT (AAH32336) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1E3
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- FHIT is a putative human tumor suppressor gene at chromosome 3p14.2 that was identified recently by positional cloning. Homozygous deletions within the FHIT locus have been observed in cell lines derived from cancers of the esophagus, stomach, colon, breast, kidney, and lung, and aberrant transcripts were observed in several types of primary tumors. This gene also encompasses the site of the t (3; 8) translocation breakpoint of familial renal clear cell carcinoma and the fragile site locus FRA3B. The1.1-kb FHIT cDNA is encoded by 10 small exons distributed over a genomic locus of about 1 Mb; the t (3;8) break falls between untranslated 5' exons 3 and 4. The protein is a dinucleoside 5', 5'''-P1, P3-triphosphate hydrolase and the histidine residues of the HIT sequence are critical for the Ap3A hydrolase activity of Fhit. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWR Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice