126786-ML550
FGFR1 (Basic Fibroblast Growth Factor Receptor 1, bFGF-R-1, CD331, FGFBR, FGFR-1, FLG, FLJ99988, FLT2, Fms-like Tyrosine Kinase 2, Proto-oncogene c-Fgr) (MaxLight 550)
Größe
£914.00
- SKU:
- 126786-ML550
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa31-150 from human FGFR1 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 5E9
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. FGFR1, also known as fibroblast growth factor receptor 1, is a receptor membrane tyrosine kinase belonging to the protein kinase superfamily, Tyr protein kinase family and fibroblast growth factor receptor subfamily with three Ig-like C2-type (immunoglobulin-like) domains and a protein kinase domain. This enzyme acts as a receptor for basic fibroblast growth factor while a shorter form of the receptor could be a receptor for FGF1 (aFGF). Binding of FGFR1 is reported to play a role in the modulation of bone elongation and also in bone development and maintenance. It also mediates two independent signaling pathways in retinal pigment epithelial cells and regulates proliferation, differentiation, and maintenance of normal myocardium. Defects in FGFR1 are responsible for several diseases which include Pfeiffer syndrome (PS), idiopathic hypogonadotropic hypogonadism (IHH), Kallmann syndrome type 2 (KAL2), osteoglophonic dysplasia (OGD), non-syndromic trigonocephaly and many more diseases. Applications: Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRMP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice